Teduglutide For SBS Research

Teduglutide For SBS Research
45-16 Ramsey Road, Shirley, NY 11967, USA
Shirley, New York 11967
Business Category
Pharmaceuticals » Pharmaceutical Preparations
Not the business you're looking for?
Find more results for Teduglutide For SBS Research
Loading
Search For "Pharmaceuticals" Companies in Shirley, New York - Click Here Now!
View Similar Companies Nearby

Direct Contact for this business listing

About Teduglutide For SBS Research
chloe-mica image
Listing Creator

About Teduglutide For SBS Research

Teduglutide, Also Known As Gattex/ALX 0600, Is Mainly Used For The Treatment Of Short Bowel Syndrome (SBS). The Disease Is Generally Due To A Series Of Syndromes Caused By A Serious Intestinal Disease Or The Surgical Removal Of Most Small Intestines. CAT#: M3412132 CAS No.: 197922-42-2 Sequence: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD M.W/Mr.: 3752.13 Molecular Formula: C164H252N44O55S Contact Address: 45-16 Ramsey Road, Shirley, NY 11967, USA Tel: 16316244882 Fax: 16316147828 Europe Tel: 44-207-048-3343 Email: Contact@creative-peptides.com

Teduglutide For SBS Research in Shirley is a company that specializes in Pharmaceutical Preparations. Our records show it was established in New York.

Company Address

45-16 Ramsey Road, Shirley, NY 11967, USA Shirley, New York, 11967

Phone Number

(631) 624-4882 Call Now!

Company Website

Estimated Number Of Employees

Information not available

Estimated Yearly Revenue

Information not available

SIC Code

2834

Categories and Products

  1. Pharmaceutical Preparations in Shirley, New York

Keywords

Teduglutide for SBS Research, Creative-peptides.com/product/teduglutide-item-m3412132-21367.html
View Competitors

Direct Contact for this business listing

About Teduglutide For SBS Research
chloe-mica image
Listing Creator
Loading

Free Job Postings


Free $50 Job Credit - Limited Time Only
Post Jobs for Free or Sponsor a Job
Post Jobs for Free & Get a $50 Job Credit

About SaleSpider

Social Media Networks: The New Advertising Mecca

Fox Business
»
»
»
Teduglutide For Sbs Research
Business Directory
Over 65 Million Businesses Worldwide
spacer pixel